SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18977905|ref|NP_579262.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18977905|ref|NP_579262.1|
Domain Number 1 Region: 30-192
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.55e-30
Family Clp protease, ClpP subunit 0.012
Further Details:      
 
Domain Number 2 Region: 373-440
Classification Level Classification E-value
Superfamily NfeD domain-like 3.27e-16
Family NfeD domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18977905|ref|NP_579262.1|
Sequence length 447
Comment nodulation protein nfeD [Pyrococcus furiosus DSM 3638]
Sequence
MTMKKAIMILTIFTLLLFAQGVKGRDSNVVYVAQITGQITSYTFDQFDRYISIAERNNAR
AIIIELDTPGGRGDAMMEIIQRIQQAKVPVIIYVYPPGASAASAGTYIALGAHLIAMAPG
TSIGACRPILGYSQNGSIVEAPPKIVNHYIAYIKSLAEESGRNATIAEKFITEDLSLTPE
EALKYGVIEVIARDVDDLLEKANGMTTKIPVNGRYIKLNFTNVEVRYLEPSLKDKLITYI
TDPNISYILLTLGIWALILGFLTPGWHVPETIGAIMIILAILGFGYFGYNAAGLLLIIVG
MLFFVAEALTPTFGLFTVAGLISFILGGILLFGGGNVEYLVSKDVFSQLRLIIIILGVII
ALFFAFGMAAVIRAHRRKAATGKEEMIGSEGTVVEELNPEGMIKVRGELWKARSKDGEKI
EKGEKVKVVGMEGLTLIVVRKKEEGGK
Download sequence
Identical sequences Q8U0Q2
Pfu-1432096-001 gi|18977905|ref|NP_579262.1| 186497.PF1533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]