SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 525.m06155 from Theileria parva

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525.m06155
Domain Number 1 Region: 125-254
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 2.09e-37
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0000187
Further Details:      
 
Domain Number 2 Region: 19-123
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.14e-29
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 525.m06155
Sequence length 263
Comment |TP01_0210|TP01_0210|succinate dehydrogenase iron-sulfur subunit, putative|Theileria parva|chr_1|c1m525|525
Sequence
MATSRFGVIFKTLPVLSPKNVNFSVFRYTPNSKEKPRMQTYTVDTNECGPMILDALIKIK
NEMDSTLTFRRSCREGICGSCAMNINGENGLACLMDIEKQASMGTVEIQPLPGMYVLKDL
VPDLTNFYEQYRSVEPWLKRKTPKVLSEEGDKEYYQSREDRQKLDGLYECILCACCSTSC
PSYWWNPEHYLGPAALMQAYRWIADSRDEYTTERLVEVNDTMKLYRCHGILNCTKVCPKG
LDPAGSISKLKKLVEENVSDGMF
Download sequence
Identical sequences Q4N9A4
5875.TP01_0210 XP_765737.1.6148 gi|71032191|ref|XP_765737.1| 525.m06155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]