SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 525.m05816 from Theileria parva

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525.m05816
Domain Number 1 Region: 534-680
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000543
Family Tropomyosin 0.0088
Further Details:      
 
Domain Number 2 Region: 696-826
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000105
Family Tropomyosin 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 525.m05816
Sequence length 1095
Comment |TP01_0533|TP01_0533|hypothetical protein|Theileria parva|chr_1|c1m525|525
Sequence
MVAIFKDDGQIDKFVLKKVEDEKADAKSDEKTDARADGKADGKGSGSGSSRVKMIKNYDD
LKKPMIRYLNDESDKSDPGKFEITANKQITNGEAGLKNNMNGMNGTVGSTGPVGNNEEFL
DPIDPFDDEFPNTNIINDNKNLNHASNNFNNAGDLNNLNGAAGINRLNMANPNIMNVPNT
MNIPNTMNVPNTMNVPNTMNVPNTMNVPNTMNIPNTMNNVGMNNVGMNNVGMNNMNMANT
MNMANSLNNIGNMPMGNPLMGNILNDTGVMGIRRDVFEDNLELKRMINRNFVQLENNINR
QNDVINTMIQKQNNLINTKLNESSNLLNTKLDESSNLLNTKLNESSNLLNTKLDESSNLL
NTKLDESNNRLNSKIEDKTSILNSKLDEKATLINILVGNNNVINDILQKQNAFMYNIIND
SVLDKLNTINDNLINTIAVIENKHKILMEDLIKSLGDNLTAVVNTVSNTLNDSTQHITNN
INNNLAHNVTHTITHSITNSITNSITNSINNSMADVNDKLHANVSVLDEKISNNLSSIND
KINDKILNLDNGVETITNILDSVKTCLDNLDDHMNEVVDRMGEVEGKMDRCDDRITELDD
NLNEFESRFDDLSVKLTAVEDKIEEINAFASETISDLKASLETVNQSLNGVNDGITEVNQ
SINEVNDNVKGINDNVNTVTDSINETLNNSFNSVNETINTDLKDNFSTVTKSIKTLNNSI
TNVNNSVITVNNSLTTVNNSINAVEDSIETVNNSLNSVDGTINSLNDTLGNSVAAVNQSI
ADVNASINTLENTVNEDVKTKMKEYKNKFKDVDTKLDQVIIKFNEFLHTFNDGKEDDTLD
SNDIQNLINLLVVKLDQFKSPDDKSKGNSCCNDVQNPCCDTGHNACVGSNSDDSAENDNK
LDKNSGDSSCSSFNSCNPPNINIPDKIYSIRENCSVSSCRNENPTTSNIPVENNVFQEYV
SGSASDYRVNMFGDSYVADFQHSRDNPANAYNFSGVTNDHLYNQNLNRVFRNNTIIRYPI
YTNNNLDPGVPYPNSYDPGSTYTANNYQPVTHENYYSGSSFTPNTANVNYVNINGQLVKH
TREVISLPEYMKTLH
Download sequence
Identical sequences Q4N8D8
gi|71032823|ref|XP_766053.1| 525.m05816 5875.TP01_0533 XP_766053.1.6148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]