SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|110402|estExt_fgenesh1_kg.C_2430001 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|110402|estExt_fgenesh1_kg.C_2430001
Domain Number 1 Region: 745-909
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.14e-65
Family Polyphosphate kinase C-terminal domain 0.0000246
Further Details:      
 
Domain Number 2 Region: 564-741
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.5e-53
Family Polyphosphate kinase C-terminal domain 0.0000257
Further Details:      
 
Domain Number 3 Region: 353-548
Classification Level Classification E-value
Superfamily PHP14-like 8.83e-49
Family PPK middle domain-like 0.00034
Further Details:      
 
Domain Number 4 Region: 243-349
Classification Level Classification E-value
Superfamily PPK N-terminal domain-like 9.94e-31
Family PPK N-terminal domain-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|110402|estExt_fgenesh1_kg.C_2430001
Sequence length 973
Sequence
MEGAAAGLGSTSVGRSSQPGRSYLFCHIESNARSSALLAGSTAMACGIKCHHWQNRVTSS
EVISVASGVRSIARKMQQRCFKKGAAGEAFSNISSQLGCGRESLERPRSQTTRLAKKKQN
AWSRGGVRVRADAVVQQSAGSDETTGNRLVENGVATLVTLKAVIDEKSGALLLKEELTKE
KNDTTHASKSKLRKLKPSKIDDLPVELRQPPMNGNVVMPPQKQEGLEADVAGIGVDTLVA
ADSVYNKELSWLAFNWRVLHMALDVRTPLLERLRFLAISARNLDEFFCKRIGALKRQEAA
GVENLINVQSRMAWTPQQQLKHVAKEVRLMVDTQIACLTEEVLPALKKNGFNLVDYEELH
LHEKDQLRLYFKSSLEPILTPLAVDPGHPFPYIGNLTSSIAVVLRDPYDDAVQFAIVSVP
SGLERWKSLAFSKNDEYNMNTFVSLEDIIINNLDLLFGGMEIMSAHVFRTTRNADVARNE
EEAEDLLEMITDEMRELRFAPFVRLEVDCKMPLEVVQRLTMELGLSDKDDVYAICGPMAL
GELDSLVGKCNLTSPLVYTLWTSKTHPRLQGADVFEVIKKGDILLHHPYHSFVTSTQHFV
EAAANDPKVAAIKATLYRTNNDSPVISALAKAAEAGKQVAVLVELKARFDEVRNMGFAQK
LEDAGCNVAYGLVGLKTHCKCIMVVRKEDDGLRTYVHIGTGNYNPRTASVYTDFGLLSCD
PDLGMDVADLFKYLTGYHRQVAYRKLLVAPGTMRNEFIWLIEREIANAQAGKPASIIVKC
NGLDDQVMVTKLYEASKAGVNIDCIVRGMCRIRTGIPNVSDNIRVVSILGRFLEHHRIFR
FENGGDAEYYMGSADWMTRNLTRRVEVVTPVEDEALQKELQEMLDACLCDRRKAWEMRPD
GRYQLLGVGNMKDPPRKHIPQVASPKLIAAVESMGLHEGLMEIVAKRCRKAKKVNLRKQD
GTAMKPRRQHDSS
Download sequence
Identical sequences Q2MEV6
3218.JGI110402 jgi|Phypa1_1|110402|estExt_fgenesh1_kg.C_2430001 PP1S243_57V6.1 XP_001778691.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]