SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|111414|e_gw1.2.76.1 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|111414|e_gw1.2.76.1
Domain Number 1 Region: 453-512
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.000000000114
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Phypa1_1|111414|e_gw1.2.76.1
Domain Number - Region: 575-621
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0942
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|111414|e_gw1.2.76.1
Sequence length 634
Sequence
MPLGPLEEDEDPFNDLDMPDRPKFQRKLTCGVCLEWIAFFVLLGAVICSRVLPKARNMAL
WGLLLWKWFLLALVIVCGRLVSGWVVRSLVIVFEINFLLRKRVLYFVYALRRGVRNCIWL
ASVLMAWNFMFDSRAQALSAKLVYITKVLQCILLAAILFLVKVFLVKLLASSFHVGTYFE
RIRDSLFNQYVLEILSGPPVLEMDRLKHEDEKLIEEVSLLKKAGATTKGLEGLPGIGENT
EARMSKNLGRSRTGISREVKPGSNITIEHLHKLNRKNVSVFNMKRLINLVKHQGVTTFGQ
GLDGGVGKGVDTEIKSEWQAKVVAKEIFDNVSSPGAPHIIEEDLLRFLSEQDTIRTLALF
EGAMETGKITKKALKSWVVNVYQERRALALSLSDTKSAVSKLHRIIDVILFVIVVVIWLL
ILDIATTQLLLFVSSQLVLMVFIFGNTLKTVFEAIVFVFVHHPFDVGDRCLIDGTMYVVE
EMNILTTVFLGDFNAKVWYPNSVLASKPITNYYRSPDMGDMFEFFIATSTTAEKIGRLKE
HIGRYITGNPQHWKETFVLNCLDCAPDTGKLKLVVGLSHTMNYHNIGEKVARKSQLILEM
KKGFEEIGIEYHLPPQDVHLKSIPGTTINFDRSL
Download sequence
Identical sequences A9RD55
jgi|Phypa1_1|111414|e_gw1.2.76.1 3218.JGI111414 XP_001751968.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]