SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|119414|e_gw1.28.62.1 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|119414|e_gw1.28.62.1
Domain Number 1 Region: 189-259
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000425
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0038
Further Details:      
 
Weak hits

Sequence:  jgi|Phypa1_1|119414|e_gw1.28.62.1
Domain Number - Region: 109-185
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00484
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.026
Further Details:      
 
Domain Number - Region: 264-363
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00589
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|119414|e_gw1.28.62.1
Sequence length 404
Sequence
VIYFRTVDLYQLCPPLVAQVAPAMGLVAFSIWGLGPTTRLIRKNIFKRSDKKWDESRTFN
IMASYMRPILLWIGIILICRAFDPVVLSTEASQIIKQRFVNFVRSLSTVLAFAFCTASLT
QQVQRFMMEHQDAEESRNIGVQFIGNAVYTSVWIAAVCLFMELLGFSTQKWITAGGFGTV
LITLAGREIFTNFLSSIMIHATRPFVDNEWIQTKIEGQEVSGTVEHVGWWSPTVIRGDDR
EAVHIPNHKFSVSVVRNLSQKTHWRIKTHLGISHLDVNKMTPIVADMRKVLAKHPQVEQQ
RLHRRVFFDSIDPENQALLILISCFVKTSHFEEYLRVKEIILLDLLKVISHHNARLATPI
RSVQRVLDETESRSAGFRDMRSANQAQRRTFLLLGSQAVSASDD
Download sequence
Identical sequences A9RTY9
jgi|Phypa1_1|119414|e_gw1.28.62.1 3218.JGI119414 XP_001757514.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]