SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|150356|e_gw1.314.34.1 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|150356|e_gw1.314.34.1
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.000000000131
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0033
Further Details:      
 
Domain Number 2 Region: 88-172
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.000000379
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|150356|e_gw1.314.34.1
Sequence length 176
Sequence
GVATAFAARDILGTILSGEALQFSRPFIVGDIISAGSVTGQVVDMDLHTAQLLISDKLPI
VVPNSFFSNQMVIINKSRARYRGLSFNLQVNIQDHEMIPIITSEISKLIMSHPKVYLENE
KLQCHVSQVGPTSLNIVVTCNLNPMATDDYLAAQEDLLIEAARIFAKTGVKFGNLV
Download sequence
Identical sequences A9TTG2
jgi|Phypa1_1|150356|e_gw1.314.34.1 XP_001781915.1.60028 3218.JGI150356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]