SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|158834|estExt_fgenesh1_pg.C_70100 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|158834|estExt_fgenesh1_pg.C_70100
Domain Number 1 Region: 445-768
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 6.58e-90
Family Phosphotransacetylase 0.000000318
Further Details:      
 
Domain Number 2 Region: 272-401
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.0000000000000302
Family DRTGG domain 0.022
Further Details:      
 
Domain Number 3 Region: 70-281
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000292
Family Nitrogenase iron protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|158834|estExt_fgenesh1_pg.C_70100
Sequence length 788
Sequence
MLRAVGKKVRRVLREELLAGLQGRGLGRIYDASGTGVRKHGWGISSRETHTNSLYIHHTI
GGVGRDSVAVTVGLLHSLERLQPGIGYFRPIDQTTIGGYRSKLIKSVFKMKDDPAIMQGV
TQDRAYELVTNDKIDDLLEEVLKAYEACRVKHDFVVVEGTSLRGGGDDTVTLNAKIAQTL
GSSALLVTDAGIACGKMDKMKNWDGFDWEKRVVNNAKLSDLVFRREHVDVVGAIVHRTPQ
TERKDKLLRKVFEEMKIPFVGALPEDSVLRSVQVQDVAKKLEAGLLYPVEDEEVAMSTEV
TQYLVATEQLSDLLRHLPRYVDPTKGSIVITSANRVDILLGLIHLHESKSNANIAAVVLS
GGKPPPREVHELLKARNSGTLPIILSPQMTFETASALANVEGYISSKTPLKVERAQTLFD
DNINMKLIKDAMFQERPVRMNSKLFQHNLFTRAKQCIQTIVLPEGEEPRTLQAAGTVLRR
GLCNLILLGDREKIETLAKQFRVDISQARIVDPRDCPETEKYARYFYESRKHKGITLGQA
HNILIGDVNYFGTCMVAEGAADGMVSGAVHTTANTVRPALQLIKTLPGIPVVSSVFFMCL
PGKVLVYGDCAINSDPTSEELAAIAIASADTAAAFGIKPRVAMLSYATGDSNKGPLIQKV
IDATAIARKLRPDLLIEGPLQYDAAVDPVIAKTKMKGAESEVAGKASVLIFPDLNTGNNT
YKAVQQTTGAVAMGPLLQGLRKPVNDLSRGCTVPDIVTTIALTAVQAAAMKETAKRETPK
ENLVASAA
Download sequence
Identical sequences A9RG05
3218.JGI158834 PP1S7_199V6.1 XP_001753120.1.60028 jgi|Phypa1_1|158834|estExt_fgenesh1_pg.C_70100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]