SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|158878|estExt_fgenesh1_pg.C_70177 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|158878|estExt_fgenesh1_pg.C_70177
Domain Number 1 Region: 160-345
Classification Level Classification E-value
Superfamily Hsp33 domain 3.53e-43
Family Hsp33 domain 0.0000349
Further Details:      
 
Weak hits

Sequence:  jgi|Phypa1_1|158878|estExt_fgenesh1_pg.C_70177
Domain Number - Region: 406-430
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.00131
Family HSP33 redox switch-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|158878|estExt_fgenesh1_pg.C_70177
Sequence length 434
Sequence
MNPLDGKPTRETVIFCLHRASATSYGRRGAPTGGRSSWNAGVLWVCEGTRKDDLRGIFCG
SPFISRNFTVRFVSREFTESSKWGRLSIRQSPAVIPKRGRSISNDVRVRSSQNEHNADLD
PLGGGDKLVRVISKDAEASLHLRIVYYHQSNANLVLQGKACAALGRTLMGTLLLGALKGD
AETVQVLFRGNGPLGNMTAISADEGHVKGFVVNPSCDPPLKDNGKLNVGLAVGSGVLSVV
RNNRNWKQPYTGTVPIYSGEIAEDIAHYLADSEQMNTALGLGIGFDKEVGIRFAGGYLVQ
VLPFCSEETLSRLEENILKMKPLSDSPSELKASDIAEAILDGIGAGDYNDTIIPRYGPCG
VEELKPRMLRAVASMEPAEIREILDEQACATTSTKNYSWKVDFEGAGAIEVKCEFCNELV
QFKETDLQQVLLSA
Download sequence
Identical sequences A9RG79
XP_001753155.1.60028 3218.JGI158878 jgi|Phypa1_1|158878|estExt_fgenesh1_pg.C_70177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]