SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|167307|estExt_fgenesh1_pg.C_1420093 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Phypa1_1|167307|estExt_fgenesh1_pg.C_1420093
Domain Number - Region: 77-126
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.0706
Family HPr kinase/phoshatase HprK N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|167307|estExt_fgenesh1_pg.C_1420093
Sequence length 134
Sequence
MVAPQLVTHISGLSSSRKGETLPGPAGKVKAVTMAEKKFDTTKMSGEELKKLGLEGARKP
PGSNPGPGSTLHQQGGQGLSKAGRYPFIMAGVAVVVGMATFTYYRSLNVQQIPGKSNQAL
ESNHPATAKAPSDR
Download sequence
Identical sequences A9SZK0
jgi|Phypa1_1|167307|estExt_fgenesh1_pg.C_1420093 3218.JGI167307 XP_001771836.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]