SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|207532|estExt_Genewise1.C_390256 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|207532|estExt_Genewise1.C_390256
Domain Number 1 Region: 409-468
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.000000000157
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0094
Further Details:      
 
Weak hits

Sequence:  jgi|Phypa1_1|207532|estExt_Genewise1.C_390256
Domain Number - Region: 544-577
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0262
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|207532|estExt_Genewise1.C_390256
Sequence length 590
Sequence
MPERPKFRRKLTWSVCLEWIAFFVLLGAVICSRILPQARNLELWGLLLWKWFLLALVIVC
GRLVSGWVTRALVLVFEMNFLMRKRVLYFVYALRRGVRNCIWLASVLMAWNFMFDSRAQK
VSRKLMYVTKVLQCILLAAVLFLVKVFLVKLLASSFHVGTYFERIRDSLFNQHVLEVLSG
PPVVEIERMKEDDEKLLEEVSLLKKAGATAKGLEGLPGISENNETQKSRKLSRSKTTPVS
GEVKAGSGITVQHLHKLNRQNVSAFNMKRLVNLVRSQGVATFGQGLDGNAEEEMDTEIRS
EWQAKAVAKEVFNNVAKLGASCITEGDLMRFMPEEDAIRALALFDEAMETGKITKKALKS
WVVNVYQERRALALSLSDTKSAVSKLHRMIDVLVLMVFIFGNTLKTVFEAIVFVFVYHPF
DVGDRCLIDGVMYVVEEMNILTTVFLGDFNAKVWYPNSVLATKPISNYYRSPDMGDMFKF
FISSATPAEKIGRLREFIGRYITSKPQHWKETFTINCMDCSPEHGRLELVLGLTHTMNFQ
NFGEKTARRSEIILEMKKGFEELGIEYHLPTQEVHVKSVDGSTINLNRPL
Download sequence
Identical sequences A9S0N5
jgi|Phypa1_1|207532|estExt_Genewise1.C_390256 XP_001759935.1.60028 3218.JGI207532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]