SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|68605|fgenesh1_pg.scaffold_19000138 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Phypa1_1|68605|fgenesh1_pg.scaffold_19000138
Domain Number - Region: 226-287
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.024
Family Tetracyclin repressor-like, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|68605|fgenesh1_pg.scaffold_19000138
Sequence length 317
Sequence
MANMVFEIVRMETDWKEWQEQLHTNMPVSAITPLEISLKSREEWQKMLEERDNQIARRES
QVRELDLLNEDLTIHLDGEPSNIEMQCSTRSKKPNLSSPIRNLQSLGKKNKSKLKQVEIQ
SLVKKSSPPTLEDIFISNPIESSLSKEVREKGLNPNSPNLVLRINQEREGSIPPSPLIEY
KRESTPTPLSINPFVQSRSLPIVIPKNLQATPMSYNLPIFKRTRNNDPLAHMERFIELLM
TYLITNPDYYLVWFSSTLKDGAYEWYRNHVLETFKNWDMLMRAFLENFRPEVGQSNAFTA
LSSLRQGKREEIIEYIW
Download sequence
Identical sequences A9RNL8
jgi|Phypa1_1|68605|fgenesh1_pg.scaffold_19000138 XP_001755826.1.60028 3218.JGI68605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]