SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|70574|fgenesh1_pg.scaffold_28000179 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Phypa1_1|70574|fgenesh1_pg.scaffold_28000179
Domain Number - Region: 31-118
Classification Level Classification E-value
Superfamily Hsp33 domain 0.0981
Family Hsp33 domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|70574|fgenesh1_pg.scaffold_28000179
Sequence length 145
Sequence
ESQRVAHDLPYRFHGPGLGFRGAPYPGRQMGPRQLENWALGASRGDYMDNSECVPRVVLL
MALARLPPATSSLGREWERARASPDRESRQSHEDAWLRVIAECSRHWRHRLSLARFRCPH
PALSPSPLLRVRGCSLLLVLFTAQF
Download sequence
Identical sequences A9RU33
XP_001757536.1.60028 3218.JGI70574 jgi|Phypa1_1|70574|fgenesh1_pg.scaffold_28000179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]