SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|100576|fgenesh1_pg.scaffold_430000005 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Phypa1_1|100576|fgenesh1_pg.scaffold_430000005
Domain Number - Region: 384-419
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00016
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|100576|fgenesh1_pg.scaffold_430000005
Sequence length 551
Sequence
MWSRLRGSILFQAILFSVPFQGTLFSVNGFLKSKNEGESLTARANFGSKLESFGTTEAIA
AEVSVVMDSQWIQDRKYKGVLKINSLGCSGFSVTSRDLPAGAKKGLRQAVEGHHQTPGAF
SSRKARNTTPLEKLPRALARNFVNIPVEILRPLTEREGGIEVFGTPLGNFLIGGTAETSN
RGSADWHDLVANKGNYIVFQNPTFSPASQQIKLFAGNNSKAMTAESSVIRIRESRDYFKI
NFRGTENSMAAGGPAVPIAVQMGTLGDRMTSVAPLPTFRGLPGGYQMTNWNDASESYPGR
SDYGTIPQGIVNVVPLQAVLPSSSQPYVPYSAYQKPIPMKELTNELVSRDPNESLVLTLT
KKMDELAVNLAKDKEKRHKSINMRPNVWCSNCKGQGHLVTECSSPPQMMVHCTFCGDKHT
TANFWNLKKQQQVKQQTMSQPTSWDVNQMQTSQPAEDKGPIQRDSPVHRVEVVNAVLISG
QQKDKNTIQDLDDPIEVTTVAPSKRRTEPISILGRIPILSPQQDEEPTSVSRANFSGTSR
SIPNDHVPIPA
Download sequence
Identical sequences A9U231
jgi|Phypa1_1|100576|fgenesh1_pg.scaffold_430000005 XP_001784920.1.60028 3218.JGI100576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]