SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|100669|fgenesh1_pg.scaffold_434000013 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|100669|fgenesh1_pg.scaffold_434000013
Domain Number 1 Region: 330-430
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-24
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 2 Region: 89-186
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-21
Family B3 DNA binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|100669|fgenesh1_pg.scaffold_434000013
Sequence length 621
Sequence
MYIHPFWRWTGGTFGGTAAAGSVFSRERHPPSICLQCMIAPASQVACSRSGSDVLKYKLH
GDEDEDADRNKRMLDSSRGRKKDAASHLLPSFLKKMTEVAIKSKLQMPVSFVRNSVTRIG
KTIILEGPSTNKWSVEVWPGSVQKRSLEFRDGWQKFVKDHNLQIGDQLCFTLTSDSHFQV
MVYDESGSQKASAMDAINSTVTIKHEPKHLSKVRSDVRTKGPEARLKQKVTKRIRIKSAV
KPTVVVVHSSDSELGNSEPPEKDENLKEIISKEKIQDCPGMDGSLADPKPLLAPHILQGG
HVVSQRRSVTPAEKERALNAARDLADTLTNPKLVMVMTKAYVYKGFWMVLNKVFSNAHMP
HESREVTLCNKAGHSWPVKWLFKTTTNSSGFSGGWRGFALDNRLEESDVCVFEMVDEKYF
VILVHLFRAIGQPSEDAGDYRPSPGRGRNANRRKRKAIDSPLDTRCTKIKLFHSGDLKSP
AGCSRAKYLYHTQSQEAENLAQMVGCSQKQQKDTCTASHGKVLHQDEGKEVTSTAITSSC
DTDFTSDNPSSEALETFERRTALQIRPLHAFQFPRRKTGSFRDYLMDLGKELVGQQAAMA
APKRSSPPASRKTQISPSLEV
Download sequence
Identical sequences A9U2C1
XP_001785000.1.60028 3218.JGI100669 jgi|Phypa1_1|100669|fgenesh1_pg.scaffold_434000013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]