SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|101193|fgenesh1_pg.scaffold_459000004 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|101193|fgenesh1_pg.scaffold_459000004
Domain Number 1 Region: 158-195
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000068
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|101193|fgenesh1_pg.scaffold_459000004
Sequence length 207
Sequence
MATGGSVVPIAVQMGDVSNRTMSMAPLPTLRDFLGADLDQHLSQFLTPFQGSYQNPTWNG
SVGAYPWMLDTKTNSSANIQGPINVIPLQAMPPNVTTTYTPYFSYQQQALTVPELSIISI
PKDSNEALLLNLTKKMEEIAVNMAVNIAKDKEKRQKSTNTRTNVWCNNCKGHGHLITKCP
SPSQMMGQCTFCGGKYLTASCWNLQRQ
Download sequence
Identical sequences A9U371
XP_001785305.1.60028 jgi|Phypa1_1|101193|fgenesh1_pg.scaffold_459000004 3218.JGI101193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]