SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|103289|fgenesh1_pg.scaffold_1791000001 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Phypa1_1|103289|fgenesh1_pg.scaffold_1791000001
Domain Number - Region: 277-316
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00968
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 33-97
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0667
Family Insect pheromone/odorant-binding proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|103289|fgenesh1_pg.scaffold_1791000001
Sequence length 404
Sequence
MDPSIASLFQAFSLSMQQQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLRCYVREME
LNRVSEKKMIALFGLATIPEIRDHITSITDHCGNSWEDFSHALKDKYFLEDIDRVTKKLF
LGWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQVADGELQEKLEPLLE
DKEEDEGLTTKWKNVEDAVGLLTKKERRKDRSNIPKQVQACKAPVRTTPPTMPTVQPSTS
LSKKTDMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDC
NEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKGHETVARESASYGA
RVDDEIGGSTETSEFWASAVSTMQKGKLPREALLRTAATIRGRT
Download sequence
Identical sequences A9U6J5
jgi|Phypa1_1|103289|fgenesh1_pg.scaffold_1791000001 3218.JGI103289 XP_001786480.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]