SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|126153|e_gw1.58.22.1 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|126153|e_gw1.58.22.1
Domain Number 1 Region: 28-536
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.19e-96
Family Acetyl-CoA synthetase-like 0.00000287
Further Details:      
 
Domain Number 2 Region: 755-1016,1043-1113
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.35e-38
Family Quinoprotein alcohol dehydrogenase-like 0.0098
Further Details:      
 
Domain Number 3 Region: 544-599
Classification Level Classification E-value
Superfamily ACP-like 0.0000959
Family Peptidyl carrier domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|126153|e_gw1.58.22.1
Sequence length 1115
Sequence
MDLLQEKVDPTSIKFTHNLKGPVKLHLPRRVVGIWIAQSVEYLVSVFAVLKVGGVFMPMD
PSWPVSRVQAVLQSAKPAILLGCRHTFLSSQNSLQAKISALEAANCQLMWIPEGFVKTAA
RETLYEVERVCATRQTNFCYILHTSGSSGTPKGVCGTEEGLINRLSWMESAYPHVNTDVG
CFKTSVGFVDHLTEALGPLLAGIPIIIPSPEILKENLLILLNYIQTYKITRLTAVPSIFR
ALLPALKSTCRNAADSLRILSLSGESLSLKLQQELHCVLENTTILNLYGSTEVSGDSSCF
DCTSLWDASSTSIQLLEDSRLSTTPIGDPINGCYHFIVVDGEKLGGVNEEGELWVGGVGV
AQSYLNDNESTREKFIDLSSSDASGISRLPPWTSFGERIFRTGDVVKKLPDGNVVLLGRI
DRQVKIRGNRISLEEIEGYIEMHPKVSRCVVTLHTRLESDMDLVAYVVYDRAMTSLLIYE
EITSNLSHELKLWLAEKLPSVMIPQIFIPLVSLPLTNSGKVDYDSLPDLIGSSVEDAKRN
SNVDSIASAVMQVFTSVLKAEKLSDTDDFFSAGGTSISAAHVAYLLNIDMHLLYMYPSAI
LLHNAIEDTKEITLGDIVSTQTQGRSYQSSVLTNTENVSRISNTKDPVLPVLKYVDDHEF
PRNVNVQGIICESLDQSLLSRKRKLDEAIFESEKATKEDCWTWNSSNQIRLSLSFSRCNR
TVNLRALVKAMKSTVEPTLTVHSQTTKVERSMHSCWRVSLQACVDASPLVVFHGEVFRVF
IGSHSHSFYSLDATSGKLQWEATLGGRVESSAAVTRDLSQVVVGCYDGFIYFLDFWNGQK
LWDFKTGGQVKCQPALDPWTGLIWCGSHDHHIYALDPASHMCVWRHDCGGSIFGAPAFNE
GSMTVYFGTTRGTVIAIQIKPTIFVSWTYECGAPIFGSLALDPSTDFVICTSVSGRVIAL
KPNGVPAWQAKTEGPIFAGATISRVLISQVLVCSGDCHLYCINLQNGSTVWKYNVGGPIT
SSAYVEEDLVLLQDRSEKHQIMERYLLLICVATTSGTVHVLRAPSAISSRSLIIFPIQEV
TDIKLPGEVFSSPVMISGRIFIGCRDDFLYCLELM
Download sequence
Identical sequences A9S9E6
jgi|Phypa1_1|126153|e_gw1.58.22.1 XP_001763026.1.60028 3218.JGI126153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]