SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|166568|estExt_fgenesh1_pg.C_1180136 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|166568|estExt_fgenesh1_pg.C_1180136
Domain Number 1 Region: 352-442
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.04e-18
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 509-602
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000255
Family B3 DNA binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|166568|estExt_fgenesh1_pg.C_1180136
Sequence length 613
Sequence
MALVTMPLVGVRHSQWYLCHGHSAMVEHHQPLEHCNKPALVPAFSVISTSLSGRLHIACA
DRSYGFSSRTNKKDNRVFSKFSQLEDGEYSTIQLPGQLSPSRCFVGRLLEKALLVLLKSQ
LDDCGDLNVAVGGSNWDLLRGKVKRIEVSAKKAVYKGIVLSEVGLAASNVRAKLGKNRLF
QQPFIVHANIRVREQDFNTSLTSSILSSSLNDILPRYSQAIQVQYDNGNLRFSSSDKQSG
RYGELKYPITVRVDVEESGEVISIEASQSASSKMTFKVGPEVKITDFQVGSSWLLLTGEF
LETKIDRDLPTSRLGISSEAAIPALYRVTSTVQNMSSHEKEDKDRLVCGTTPSTNPSFIK
TVRHSRNLVALEIPAPFVKEHGHNMKANVILQGPSGRLTVVHLTIRSYDVQDRVHFGGSG
WKTFVLENGLKVGDHLIFSLLQMTTIHEKSAAPKLPVSFVTQAPSPLSATHLWASPQNLS
LPHVKNEVVYARGTERTKRNVDMLIDKFHCPHFVTAIRESNLASKLCVPAEFFLKYEKFF
AERINTFQGLTGRVVQLRFSSTRNLSFTIGWEDFRNENSIKLGDVLLFSLRAPGCWLVQL
VESSVDELYMGND
Download sequence
Identical sequences A9SU27
jgi|Phypa1_1|166568|estExt_fgenesh1_pg.C_1180136 3218.JGI166568 XP_001769806.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]