SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|196691|estExt_gwp_gw1.C_2710054 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|196691|estExt_gwp_gw1.C_2710054
Domain Number 1 Region: 198-287
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.21e-29
Family Canonical RBD 0.00011
Further Details:      
 
Weak hits

Sequence:  jgi|Phypa1_1|196691|estExt_gwp_gw1.C_2710054
Domain Number - Region: 128-147
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0101
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|196691|estExt_gwp_gw1.C_2710054
Sequence length 288
Sequence
MGGRRNLRWGDAAEEDDEIEGVLPPTQVFGPDEKGVKIIIEWKKNDDNVRTKVIKTIRVK
KQMKKLNPATIRRRSLGKFGDALGQNASDNLTVVSTEEIFLERTRPAGAKAEPEKGADLA
SLGNASLIVCRTCGKKGDHWTSKCPFKELAASRGIIAGGEKPPTDDNVPGISAGAGGKGS
YVPPSMRYGKGNEGESMKRPGRDDNSIRVTNLSEDTREQDLQELFSPFGSISRIYVAFDR
ETGLSRGFAFINFVNRDDAIRAINKLDGYGYDNLILRVEWATPRADRS
Download sequence
Identical sequences A9TNB3
XP_001780104.1.60028 3218.JGI196691 jgi|Phypa1_1|196691|estExt_gwp_gw1.C_2710054 PP1S271_56V6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]