SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|209318|estExt_Genewise1.C_530135 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|209318|estExt_Genewise1.C_530135
Domain Number 1 Region: 439-561
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.12e-20
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|209318|estExt_Genewise1.C_530135
Sequence length 616
Sequence
MRAYDWRDHLKADVVAGITVGTMLVPQAMSYAKLAGLHPIYGLYSGFIPIFTYAFFGSSR
QLAIGPVALVSLLVTNGLSPFVDRSEEGADEKYTELAILLALMVGLLECAMGLARLGWLI
RFISHSIISGFTTGAAIIIGFSQIKDFLGYEVTTGSKFIPLVRSIIAGWSQFKWQSFVMG
CFFLAVLLVMKHLGKTYKHLQMLRVAGPLTAVVCGTVFVKLYHPQSISVVGQIPQGLPGF
SLNYRFSYAVQLMPTAALICGVAILESVGIAKALAAKNGYEIDSNQELFGLGVANLLGSA
FSAYPTTGSFSRSAVMQETGAKTGFSGLFMGLLGTSSLLFLTPLFADIPQCALAAIVISA
VVGLVDYDEAIFLWRVDKKDFLLWLSTSTLTLFLGIEVGVLVGVGVSLVFVIYETANPHM
AVLGRLPGTTVYRNVLQYPDAFIYHGIVILRIDSPIYFANITFIKERLREFELHTGVSAN
KGYDVGRIKFLIIEMSPVTYIDSTGIHAIKEIYHEYKSRQIQMALCNPSPRVMETLAKAE
IPDLIGESWYFVRVHDAVQVCLSHLQAEHPPEENDSPQVLNRSSHERSGNHAPWRHEALR
SDPERSSLISSVDGAV
Download sequence
Identical sequences A9S7B7
XP_001762174.1.60028 jgi|Phypa1_1|209318|estExt_Genewise1.C_530135 3218.JGI209318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]