SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|231964|fgenesh2_pg.scaffold_147000048 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|231964|fgenesh2_pg.scaffold_147000048
Domain Number 1 Region: 16-90
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-18
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Domain Number 2 Region: 268-296
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000607
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|231964|fgenesh2_pg.scaffold_147000048
Sequence length 784
Sequence
SVFAKEADALLAIRPIYSEPPPELKCPLCGTIFKDAVMIPCCQYSFCDKCIRDELIAKGK
CPQCESTKFKNDDLLPNINLRQAIDRFLEAQMTTSGASDSFYKQHQLPDVDSGPRKVAAP
AGSRLQIELRKPVISTGAPVQAPPSKEVVVEDAVESSKDKKEKTEQVEGSAVLTLGDEDS
GGAIEGPPSKEYAAETSGKEEAGVSLKEEERQGFVNDEGEAGMISKNIEPLFVKETDGVA
VESEVSKGKKKKKRSRPVQADGAADNIGGGKVRKGERVCYLCGSPDHFARDCIDHGGPGP
GPYGGPHPAMFGPGGMPPMGVPPYGGAYNMEWHGPPMPPHGGPFGYGEGMHGPGPGMMPF
DRPMMPGPGYGAPPFGMPPMYPGIPHHGYMRGPGMMGMMDRPPLSREEFLEVQERQRQER
HRQHRMMEHSEREWSPEALFPRDRERERDGNVRHQSPELESRRLKETRERRPDHYDHVRK
HDVERESGDEFSDDTEYRKTKSGRIERRKAPDRVVVENRHSRKSHLSNDDDVTSLDELKT
RRPVRRGDRDEKLPERDMRRERESSRQHREFVDYSSEHDGPVVPERHDREGSRSLKSRRM
ESSSKRINVSGESRYRSSKREMPEDSGHSDLPPEPQDLRLKLGRKREKERQERRHHVYDD
AETEEIIKGEALEKPRLKRHHSRSKSKGEEPVEYDSEDSRRKQKRKHRKHYDDSIEDRPR
DIREKDVDEPVASRKLKSKGGSNPSSNSIEGTRWQLVDSAGEIDEGHNSHSYHTKRKSQR
SYRS
Download sequence
Identical sequences A9T0S7
3218.JGI231964 XP_001772167.1.60028 jgi|Phypa1_1|231964|fgenesh2_pg.scaffold_147000048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]