SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|64580|fgenesh1_pg.scaffold_3000032 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Phypa1_1|64580|fgenesh1_pg.scaffold_3000032
Domain Number - Region: 98-139
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00384
Family Retrovirus zinc finger-like domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|64580|fgenesh1_pg.scaffold_3000032
Sequence length 221
Sequence
MGAYLQMLDRRANSGANIQGPINVTSLQAIPPNMTTMYALYFPYQQQALTAAELPIISAP
KDINEALLLNLTRKMEEMAINIAKDKEKRQKPTNTRTNVWYSNCKGHGHLVTECPSSSQM
KDQCTFCRGNHLTANCWNFQRQQQFSNQTMIPPIHWDVNQVQSRNTFGWNGNESNRQNRT
FRSVDPKARKNGGDKSRASRFFDKSSGMCPSHSYQESTKRE
Download sequence
Identical sequences A9RDC8
XP_001752257.1.60028 jgi|Phypa1_1|64580|fgenesh1_pg.scaffold_3000032 3218.JGI64580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]