SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|67906|fgenesh1_pg.scaffold_16000137 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Phypa1_1|67906|fgenesh1_pg.scaffold_16000137
Domain Number - Region: 288-327
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0105
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|67906|fgenesh1_pg.scaffold_16000137
Sequence length 456
Sequence
MENENKNFEGFLGEVSGRESSKGQGMHMDPSIVSLFQAFSLSMQQQQSNDRKKALATKAL
QAVVNKIDQFDGRNISRYLRCYVREMELNRVSEKKMVALFGLATIQKIRDHITSITDCCG
NSWEDFSHALKDEYFLEDADRVTNKLFLGWIERPNKNLQATELLREFERQYSQLSKVEKL
TLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKRKDRSNIPKTVQAPKAPVRTTP
PTMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIW
CDDTSHTRKDCNEFNNMIRQGIICWKDGKIALKNSSTNFGKGGMRALVQDYLKEHETVVR
ESASYGARVDDEIGGSTETSEFWASAISTMQEEKLPREALLRTAATIRGRTGWKDPVESL
SVHAYIAKSQHEALMEEKRRGNFDDTREGNSSKRQT
Download sequence
Identical sequences XP_001755078.1.60028 jgi|Phypa1_1|67906|fgenesh1_pg.scaffold_16000137 3218.JGI67906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]