SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|69495|fgenesh1_pg.scaffold_23000097 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|69495|fgenesh1_pg.scaffold_23000097
Domain Number 1 Region: 140-175
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000017
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|69495|fgenesh1_pg.scaffold_23000097
Sequence length 469
Sequence
MVIKNENLTVKKIRQSRKRIERSQARNLLQNEQQRKLKRNHRQSWIKPWLHACRHIRAYS
EANRHLIFQKYIPLKKLPRALAENLVNRPGFLLRPLTKSGGITEELSTPLASKDSNEALL
LNLTKKMEEMAVNMAKNKEKRQKSTNTRTNVWCSNCQGYGHLVTECPSPSQVLSKCTFCG
GKHLTANYWNLQRQQQFSNSTMIPPTPWDVNQIQSPRKIEGINRGPQDSLVNLVECVHTI
LTRSQQKGKGQSHLITDPFHSGFDTGKVLSPDLVAKPNEVPITESSVPSRTDLFPPQFQK
ASYPLKDPLRKGSPKEAQAAVPIPSLGQQNNLPHRVKLKPMKRKRNILREYSRNLLEVSR
DFFLEGSRNLSLERSKDYVPNITSSFSFEVSEKQCYRQSIPTQENEDLSHNLCYELQLLF
TRQVIQWSLKPTAGSTSNTITSDLLLGILRRRRGASGSSSRGRLRKLVA
Download sequence
Identical sequences A9RRE8
3218.JGI69495 jgi|Phypa1_1|69495|fgenesh1_pg.scaffold_23000097 XP_001756563.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]