SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|80431|fgenesh1_pg.scaffold_86000058 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|80431|fgenesh1_pg.scaffold_86000058
Domain Number 1 Region: 139-184
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000628
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|80431|fgenesh1_pg.scaffold_86000058
Sequence length 309
Sequence
MFVKEVQSATIVASLERAKIWEECHYDQYLTVGATMIPSQGGYQMTNWNDASKSYPGRSD
YGTIPQGIVNAVPLQAVLPSSSQPYVPYSAYQKPIPTKELTNELISRDPNESLLLTLKKK
MDELAVNLAKDKEKRHKPTNMRPNVWCSNCKGQGHLVTECSSPPQMMVQCTFCGGKHTTA
NCWNLRKQQVGQQTMSQPTSWDVNQHMQTSQPAEDKGPVQRDSPVHRVEVVNAVLTKGQQ
KGKNPIQDLDDPIEVTTVALSKRRTEPISVLGRIPILSPQQDEESTSVSRANFSGTSRSI
PNDHIPIPA
Download sequence
Identical sequences A9SJY6
XP_001766688.1.60028 jgi|Phypa1_1|80431|fgenesh1_pg.scaffold_86000058 3218.JGI80431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]