SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|84275|fgenesh1_pg.scaffold_121000076 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|84275|fgenesh1_pg.scaffold_121000076
Domain Number 1 Region: 105-201
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-20
Family B3 DNA binding domain 0.0092
Further Details:      
 
Domain Number 2 Region: 346-429
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-18
Family B3 DNA binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|84275|fgenesh1_pg.scaffold_121000076
Sequence length 736
Sequence
MVKTMSCPCVLGLVFEGYCIERLLLQNLDFRIVFLDHLLRIFYAILLLTKTCCSGSQFWN
LKIAKRELEALTNCLRLHGAEEDDVHPNLLCTPGGSEADKNVQTDRHPSFLKTMTESTID
TLKLPRSFLLDNSGRLSDSVILEGPCREQWRVELHGYGQSFNVSFGQGWSKFVVDHVLQV
GDHLVFFLLQKSYFQVEVYDGFGVQKRSALDAVNTPLKTNTKNVDVVQQSLDLDHGVVQT
EQKKPESATQPENAAQPLIDLIQSSESESMLMSARKIDMIIAEALRSEDSGHPIMKSPEV
EKRKVLPPHVLVNGTVTSKRRPVTELEKARALQAASSLELVKPNVLVVMTKSHSIPKRFS
KDWLPSETKEVTLTNKSGHTWPAKWLASQGGLSAGWRRFSLDHRLEEHDVCVLELVDKAN
LVLLVHIFRVLGSPEEDEGLYFPTNSAVKAFDGKRNISNSPQVHDDHKGVSPYGNGSESD
KKGSEHSSRGSDGLNDKSTSEPDKMTNSLKRKICVLGLEALPDKTKALGDQSHRETGTAA
IHDVQAAEPDLGVRTRDPCGAELRPTAARQDLVDFRSTLMKLTKDLLVKNGVGSIVPAKG
VLPGNPAANADDVHEQLTNFVDFPTTKRQHTLPSVSQEGDGKDQSGEDNANLADAPIPEQ
HTPSVRHERPRKELGQEYKVVHIYKGRSVGTSTEFLAELEGYSESIVSKLPRDDDTGFLW
VPSNQFSWDMQTCCIE
Download sequence
Identical sequences A9SUU7
3218.JGI84275 jgi|Phypa1_1|84275|fgenesh1_pg.scaffold_121000076 XP_001770140.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]