SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|86461|fgenesh1_pg.scaffold_146000007 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|86461|fgenesh1_pg.scaffold_146000007
Domain Number 1 Region: 130-167
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000654
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|86461|fgenesh1_pg.scaffold_146000007
Sequence length 251
Sequence
MFVKESQPVTVAASLVRAKVWEECHYDQLLMVGTTMIPSVGNQVPMTNTMIGSYPRIIAP
SIGNPNSQGVVNATPLQAIPPVATYPSPMAYRQPEVPMNATINDSNEALLLNLMKKMEEL
AVHMTKDKEKRHKPSNMRPNVWCNNCKGQGHFDTECPSPHQKMGQYMYCGGKHNTANYWY
LPRQQTMIQPTVWDVNQVQTENMGGWNRNRNNRVNRGFGNFQNPNYNQPYGTNMQNGGQN
QMGNQPSMPIQ
Download sequence
Identical sequences A9T0H3
3218.JGI86461 XP_001772120.1.60028 jgi|Phypa1_1|86461|fgenesh1_pg.scaffold_146000007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]