SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|87432|fgenesh1_pg.scaffold_157000069 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Phypa1_1|87432|fgenesh1_pg.scaffold_157000069
Domain Number - Region: 251-290
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00994
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|87432|fgenesh1_pg.scaffold_157000069
Sequence length 562
Sequence
MDPSIASMFQAFSLSMQQLQSNDRKEALATKALQAVVNKIDQFDGKNISRYLRCYVREME
LNRVSEKKMVALFGLATIPEIRDHITSITDRCGNSWEDFSHALKDEYFLEDADRVTKKLF
LGWIERPNKNLQATELLLQAADGELQDKLKPLLEDKEEDEGLTTKWKNVEDAVGLLTKKE
RRKDRSNIPKTVQAPKAAVRTTTPTMLTVQPSTSLSKKANMGMEEIIRGMRDLQIKLARL
EENTSINNLKNVSKQGYVQRCIWCNDASHTRKDCNEFNNMIRQGIICWKDGKIALKDRED
LLQTNFGKGGMRALVQDYLKEHETVVRESASYGARVDDEIGGSMETSEFWASAVSTMQEG
KLPREALLTTTATIRGRIGCEDPVESLSVHAYIAKSQHEALMEEKRRGNFDDTREGNSFK
RQTQGDKAREAASQELPVKDTSISLGEKTTETKDKGKSIAYKLLSDIEAATNLKGVLEER
ILNAKVEFTLKEVLGIVKKEFHDVIIDSIKRKRDEEEVDIGYKQPTNEKNGYNQRVHCRI
TCFPAQKCAGRLAVECSIEIPR
Download sequence
Identical sequences A9T325
3218.JGI87432 jgi|Phypa1_1|87432|fgenesh1_pg.scaffold_157000069 XP_001773014.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]