SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|87785|fgenesh1_pg.scaffold_161000059 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|87785|fgenesh1_pg.scaffold_161000059
Domain Number 1 Region: 106-143
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000314
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|87785|fgenesh1_pg.scaffold_161000059
Sequence length 461
Sequence
MMIPSQGGYQMTNWNDASESYPRRSDYGTIPQGIVNVVPLQAALPSSSQPYVPYSAYQKP
IPTKELSNELVSRDPNESLLLTLTKKMDELAVNLAKDKEKRYKPTNMQPNVWCSNCKGQG
HLVTKCSSPPQMMVLCTFCGDTNKPAGGGQGPVQRDSPVHRVEVVNVVLTKGQQKGKNPI
HDLDDPIEVTTVALSMRRTEPIPVFDRIPILGPQQDEEPNSVLRANFPGTSRSIPNDPVP
IPAQPNISSCPLKEPLVVEESTKRKELLPNRCIRTSPIKIRDSCFITSSTVRRGTLCVAA
FSILSRIVEAEFISGEFTANHSISANTQSFIMSREKVKRASEKEEEGRRVRSRSNMDELS
LCILTNMESMRLEICWNATRQKDFRSAQLYPFLQAADNLPSIDVELLEEYLTNYDPEDGS
SVVKGQTLGIDENTLHKALQLSIRVSGWRRRVFRLQSRKLF
Download sequence
Identical sequences A9T408
jgi|Phypa1_1|87785|fgenesh1_pg.scaffold_161000059 3218.JGI87785 XP_001773317.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]