SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|88191|fgenesh1_pg.scaffold_166000042 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Phypa1_1|88191|fgenesh1_pg.scaffold_166000042
Domain Number - Region: 304-342
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0314
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|88191|fgenesh1_pg.scaffold_166000042
Sequence length 936
Sequence
MENKNKNFEGFLRGVSGGESSKGQGMHMDPSIASLFQAFSLSIQQQQSNDQKEALATKAL
QAVVNKIDQFDGRNISRYLRCYVREMELNRVSEKKIVTLFGLAMIPKIRDHITSITDRCG
NSWEDFSHALKDEYFLEDADRVTKKLFLGWIERPNKNLQATELLREFERQYSQLSKVEKL
TLEPNKVDLFLQAADGELQEKLELLLEDKEEDEGLTTKWKNVEDAVGLLTKKETSKDRSN
IPKTVQASKAPVHTTPPTMPTVQPSTSLSKKADMEMEEIIRRMRDLQIKLARLEKNTSIN
NSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIVLKNREDLLQTNFG
KGGMRALVQYYLKEHETVARESASYGARVDDDLGGTTIRGRTGWEDPVECLSVHAYIAKS
QHKALMEEKRRGNFDDTREGNSFQRQTRGDKAREAASQELPVKDTSVSFEEKTRETKDKG
KSIAYKLLSDIEAAINLKGVLEERILNTKVEFTLKEVLGITKKEFHDVIIDSIKRKRQLM
GETGMSHAIDARICRDEEEVDIGYKQPTNEKNENNQRVRFEDSSDKEMETLSHYTRKHWA
RATTEVLVKVGDIEEPIVALVDHGSEINLMSKDLYKKQKWPIDMEHGWAIRAANNTRGEL
YGACPDMETKVLDDGSSYAMVRSEDGRKAVQFLTVPPNYERNRDRLREKPLPKIVEGFKD
FGENGNIMYKKVDDFKRKERKRLYDIEGQLRKIGTLQDDERILGVYEENGLEDSLELITS
IGLGNNDKIVDIHSREVYTMLESFQAPEVTVETRYKTADKKVKPVVGPLPEDSKEQIGEA
SKEASLRDPMSIGHQFTEETFEELKIDSDGSLLPEEITCFKKMLAKQGRSFAFESHEIGC
VDLNIITPMVIFTVPHVPWNLRPILRGHIYLNWWNY
Download sequence
Identical sequences A9T536
XP_001773709.1.60028 3218.JGI88191 jgi|Phypa1_1|88191|fgenesh1_pg.scaffold_166000042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]