SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|88498|fgenesh1_pg.scaffold_170000044 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|88498|fgenesh1_pg.scaffold_170000044
Domain Number 1 Region: 379-472
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.82e-21
Family B3 DNA binding domain 0.0078
Further Details:      
 
Domain Number 2 Region: 139-234
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.45e-20
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|88498|fgenesh1_pg.scaffold_170000044
Sequence length 701
Sequence
MQQRCWKIDDSGDDDCASPRRCRLRNGVIRMHNELRGHCFAFHGGWVCGSMCFSIENLSL
SVVWHPRLCHNCALRRRSSEQYSCTSILQSLFPDKMERACELCLKNCLRLHGAEESEAAK
SCLICVLWRSEGVKSDQTDRHPSFLKKITESTMSTLELPTSFVRDYIGSLHESVILEGPS
SKQWRVELHGYGEGFNISFGQGWNNFAVDHGLQIGDQLSFSLSKKSYFQVEVYDGFGVLK
RRAPDVINTPMEVSTKNVERKNQQNLDTSPCVGRTEPNNLKNATQPAGHLLTNLAKLTRS
ECRIISSPNIDAEIAKASKSEDSRHSIMQFARVDKGELLPPHKFVNGTVMSKRRPITELE
KVVALKAARALNLVKPNTLVVMSKGHVYKGFLLGIPKQFSKDWLPSESKEITLANKSGHR
WTVKWLPSHGGLSAGWRRFSLDHRLEEYDVCVFELVDKAHFVLLVHIFRVLGSPQEDEGL
YTPTSPLAKSSEGKRNNRKPFQVSQDIKVDSTPRKASGHVTKRSQHSSPGPDSQNGKSTS
EPAVEVISLKRKICVLALPALSAKKGLGNQNHQPSDTVRAGPNIEAAVDSALSAYTDFGG
KVRVAPRAPCDVERTPTTARQDSEAFRSELMKLTKDLLIRNGVGRADPTKHVLPDGHALS
ADDMHKHLAKFVDTPPSVSRKGKGEWRGREYKVVRICRGRN
Download sequence
Identical sequences A9T5X3
3218.JGI88498 XP_001774017.1.60028 jgi|Phypa1_1|88498|fgenesh1_pg.scaffold_170000044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]