SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|88752|fgenesh1_pg.scaffold_173000072 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|88752|fgenesh1_pg.scaffold_173000072
Domain Number 1 Region: 660-742
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000334
Family B3 DNA binding domain 0.0083
Further Details:      
 
Domain Number 2 Region: 84-178
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000706
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|88752|fgenesh1_pg.scaffold_173000072
Sequence length 942
Sequence
MATLPELVHLTALHAEQLLGHEWGCEEEEEEEDDEESFDCMANSSFESVGSDIETTHGTG
LPLIVPRFLKTIPEYSTPSNKNCNLRFQWLLSASSFSEKKIPAVYIREYIGMYSNETYIL
EDVTGFEWVVTFSSAALRDGWKAFAIDYQLEKGDQIMLGLLAMKRFSVNVFNKFGLEKVS
TRQPLNRRSSTGTVIDKETELLPLVSKPMRGVAEDPPLNLVHSKATNRREKLNGSPQHDS
QMPESNSFCSVLPAEASDQNENKVTKGILRSRGSFEWNLLHEQVDRDEAKTSVMNMSSEE
SEDSVQVLLAKAILAKAKQRRLKKRKMAFAGTSPVETRTEATYSERIFRNEVSKIFEDKI
RAMNLKSRNVGMASSGSAGLSSGDLIDSLKNDFAASHYDTGAVKSREDPKVSMNGNNDHD
VEVSQVDVCHRRYEPQNQNEITDQLGVVKEISLPDHRQTEVRTQTKTARVEIEDDPMRRR
VEIRQVGVLRSEPGGRDQPISVFQPALVKQEPSLSLGNNLGSAMAAARAHSHDNEKSANC
GFATVAANHRFGAVTLVGPRTREYRNLKRDYMTSEDQEPPDAISPNSNAPSSLAGDNKLR
ESQKQAYEVAKAFSVNTKNPSALLLMRTRASKNTYTCIALDCRRYCGTLTIYCLALPCSN
SMFVSVECAEILPTVPAELILMDTDGVMRKVDWRPGLRYLYGQGWKDFVETHNIQAGDVC
VLEKTDMFEYKVLIHVFRSNDIERVSPAQAPAATPKFGASPGGKFRAEGKRDRRANSPLL
PCTDKFRKCLTKAPTNGVEEGELPKSADVESAGVKRPGSFREREGAARRGSAGQSLFATH
AQIRKVAEAGTRSSPPSAVVDKQQEQQATPSQDARKHYVVQKLIDRRKSLQGLVFLVEIN
EEIMPLVGSKKKTKIGATQDERGRWWVPHHHFNFDFSSCYIE
Download sequence
Identical sequences A9T6K2
XP_001774199.1.60028 jgi|Phypa1_1|88752|fgenesh1_pg.scaffold_173000072 3218.JGI88752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]