SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|89433|fgenesh1_pg.scaffold_183000021 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Phypa1_1|89433|fgenesh1_pg.scaffold_183000021
Domain Number - Region: 46-85
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0133
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|89433|fgenesh1_pg.scaffold_183000021
Sequence length 510
Sequence
MPTVQPSTSLSKKTDMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCD
DASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKGHETV
ARESASYGARVDDEIGGSTETSEFWASAVSTMQEGKLPREALLRTAATIRGRTGWEDPVE
SLSVHAYIAKSQHAALMEEKRRRNFDDTREGNSFKRQTRGDKAREAASQELPVKDTSASL
GEKATETKDKGKSIAYKLLSDIEAATNLKGVLEERILNAKVEFTLKEVLGIAKKEFHDVI
IDSIKRKRQLMRETGMSHAIDARICRDEEEVDISYKQPTNEKNGYNQRVRFEDSSDKEME
TLSHYTQKHWARATTEVLVKVGDIEEPIVALVDHDSEINLMSKDLYKKQKWPIDMEHGWA
IRAANNTRGELYGACSDVKIWIGDVATEQHFFVQDTTSYPLILGQPYITATRMETKVLDD
GSAYARQEDESDMDNEGDEDELDKDVGDIF
Download sequence
Identical sequences A9T8D7
jgi|Phypa1_1|89433|fgenesh1_pg.scaffold_183000021 XP_001774901.1.60028 3218.JGI89433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]