SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|89545|fgenesh1_pg.scaffold_184000058 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Phypa1_1|89545|fgenesh1_pg.scaffold_184000058
Domain Number - Region: 249-287
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0392
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 430-519
Classification Level Classification E-value
Superfamily Acid proteases 0.0544
Family Retroviral protease (retropepsin) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|89545|fgenesh1_pg.scaffold_184000058
Sequence length 831
Sequence
MRPDLVGQLNAIQLWEHPGLTTGLLANMRPELVWRLNVVPITGVPIPFQAVPSFVPFRDD
CFVKSKLRSLGGVFGGGSSKGQDADRVTKKLFLKWIERPNKNLQATELLRKFKRQYSQLS
KVEKLTLEPNKIDLFLQAADGELQGKLELFLEDKKKDEGLTTKWKNVEDAVGLLTKRERR
KDRSNIPKTVQAPKAPVCTTPPTMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEE
NTSTNNLKNISKQGYVQRCIWCDDASHARKDCNEFNNMIRQGIICWKVRKIALKDREDLL
QTNFGKGGMRVLVQDYLKERETATRESASYGARVDDDLGGRTKTRKLPREALLRTAATIR
GTTDWKDPVESLLVHAYIAKNQHEALMEEKRRGNFDDMKYIKMKKRLILVTSNQQMKRMD
IINEVTTEVLVKVGDIEEPIVALVDHGSEINLMSKDLYKKQKWPIDMEHGWTIRATNNTL
GELYGACPDIKIWIGDVATEQHFFVQDTTSYPLILGQPYIMATWMETKVLDDGSAYAKRD
YRGIKEEVLSRDEGSFDASFIGILENGNIIYKKVNDFKRKERKRLYNIERELRKLGILQD
DERILGVYEENGLEDSLESITSIGLGDNDKIMEIHSREVYTILESFQAPEDTVETRYKMT
NKKLKLVTRPLPEDSKEQMEEASKEASLRDLMRIGHLFTKETFGELKIGSDSSLLSEEIT
CFKKMLAKQESVERERTNSTTGEPGLKSQLDLILRHSIQVLLPNMRPDLVGQLNAIQLWE
HPGLTTGLLANMRLELVGRLNVVPITGVPIPFQAVPSFMPFQERPFDKRIS
Download sequence
Identical sequences A9T8P3
3218.JGI89545 jgi|Phypa1_1|89545|fgenesh1_pg.scaffold_184000058 XP_001774945.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]