SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|93515|fgenesh1_pg.scaffold_243000041 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|93515|fgenesh1_pg.scaffold_243000041
Domain Number 1 Region: 30-140
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.44e-18
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 232-327
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000844
Family B3 DNA binding domain 0.0061
Further Details:      
 
Weak hits

Sequence:  jgi|Phypa1_1|93515|fgenesh1_pg.scaffold_243000041
Domain Number - Region: 652-693
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00314
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|93515|fgenesh1_pg.scaffold_243000041
Sequence length 717
Sequence
MTFSEPETVETKLSCRDFKEMLHCLQCSIYFVQKLTASNVLGIYTRRRTCQLTLPRQFVR
EHGNRIRKSVVLLSGLSHGPWNLWLSICPSRPVMPEVTFSSGWRAFVAFNGLEEGDHLIF
SLTAVSQFQVYIFNGNGHQKKPQMLEASVKWSDGIEFPQKKILNQSLGYNLAEGNAGLVC
NVCPICARRRPLSEKEFAGTASTDTCSQSSPHSSALNAQVSLEFSQKCRKYFPSFSKRIV
ARDVFRLEIPQHFAVKYGSQLLDSIQLQGIHESSPVRNLQTISHLDKARVRLYLAGAGWD
NFVTENMLRVGNELVFYLSADSFFKVREDSYWNPVTGLNNVPSHAPAVLVTVMKPESFTL
EHVVDSTVAYDSMFEKPAHSFKFVDILPRNEEMDLKGGNMKERMGNPHSGTTKEGTGTTE
TPQISTDESSVRRFGDPMTGKKREKSSSGLHNLFLFFLCKRYKHGTAEALVKEIDIEVAD
LNYISPRNSTSCESHFYGPVTQPCILTLCAKLGYVCLELLRSKFVDGHLARIRVRIRFSN
SHPQCKLMQRILQKSPLQSCCSTEIYSERHHARECSGEASQRKPLTSDPSFLKLLTLTRI
NHLVGSCKKSSFWNHSKFPSTSTGHTAICFARSSSFRGFQNGSPVHTVAIYVRYDRVRPR
LSLRKRGKNFCTKNGLEVGQELVFTLTADSCFVAGPWVQSSKVPLVSAFSKTALNQI
Download sequence
Identical sequences A9TJC8
jgi|Phypa1_1|93515|fgenesh1_pg.scaffold_243000041 3218.JGI93515 XP_001778697.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]