SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|109898849|ref|YP_662104.1| from Pseudoalteromonas atlantica T6c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|109898849|ref|YP_662104.1|
Domain Number 1 Region: 637-811
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.96e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0021
Further Details:      
 
Domain Number 2 Region: 3-191
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.16e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0056
Further Details:      
 
Domain Number 3 Region: 506-645
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.13e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.016
Further Details:      
 
Domain Number 4 Region: 149-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.2e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|109898849|ref|YP_662104.1|
Sequence length 861
Comment nitrite reductase (NAD(P)H) large subunit [Pseudoalteromonas atlantica T6c]
Sequence
MSANTVNIVVVGNGMVGHHFVEQITNHGKTDPSITYKVTVLSAEPRLAYDRVHLSEYFSG
KTADDLALTTPAHYEALGVDFHLDAAVVDIDKLGKFVKTKSGQVFAYDKLIMATGSYPFV
PPIEGNDQPHCLVYRTIEDLEDISASAKVSKTGVVVGGGLLGLEAANALREAGLETHVVE
FAPQLMAVQVDTGGGRLLKDKIEALGVQVHTQKATQRIEAGQTSRYRMCFADGDFLETDM
ILFSAGIRPQDTLARQYEIKIGERGGIVVDNHCLTSEPDIYAIGECALWNNFIFGLVAPG
YTMARAAASHITGGDVEFLGADMSTKLKLMGVEVGSIGDAHARIPGAQTYIYENQPDGVY
KKMVVNHEQSVLLGAVLVGDTSDYDTLLQYALNGIDLPEHPESLILPASGDAPAGGLGAD
ALPETATICSCHNVSKGDIIAAFDGGACDLASVKSCTKASTGCGGCSALLKTVVDSELGK
RGVEVKKDICEHFAYSRQELYHMVKVGKIQSFDELIEKHGHGLGCEICKPAVGSIMASVW
NDFVLEKPHVALQDTNDTYLGNMQKNGTYSVVPRIAGGEITPDKLIVLGQVAKKYNLYTK
VTGGQRIDLFGARVEQLPPIWEALIAAGFETGHAYAKSLRTVKSCVGSTWCRFGVQDSVG
QAIDLENRYKGLRAPHKIKFGVSGCTRECAEAQSKDIGVIATENGWNLYVCGNGGMKPRH
ADLFATDLDDATLVKYIDRVLMFYVATADRLQRTSVWLENLEGGLAYLQDVVINDSLGLG
EELEQQMQHIKDTYQCEWKTAIEDESSRKRFRQFVNSEQSDKNVVFVQERAQIRPATEAE
LETLAKSGKGTEQIIDVVELA
Download sequence
Identical sequences Q15ST8
gi|109898849|ref|YP_662104.1| WP_011575316.1.28837 342610.Patl_2534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]