SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|109900336|ref|YP_663591.1| from Pseudoalteromonas atlantica T6c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|109900336|ref|YP_663591.1|
Domain Number 1 Region: 147-342
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.2e-57
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000512
Further Details:      
 
Domain Number 2 Region: 428-560
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.14e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000195
Further Details:      
 
Domain Number 3 Region: 11-143
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.11e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.00028
Further Details:      
 
Domain Number 4 Region: 344-420
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.0000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|109900336|ref|YP_663591.1|
Sequence length 569
Comment sulfite reductase subunit beta [Pseudoalteromonas atlantica T6c]
Sequence
MTTDNKFVVEGKLADNERLKGESNFLRGTIAEDLKDDLTGAFVGDNFQLIRFHGMYQQDD
RDLRAERAKQKLEPLQNVMLRARLPGGIIKPQQWLAIDKFAEEKSLYGSIRLTTRQTFQF
HGVLKPNIKLMHQTLNQVGIDSIATAGDVNRNVLCTSNPIESAVHQEAYEWATKISEHLL
PKTRAYAEIWLDGEKKETTDHEPILGANYLPRKFKTTVAIPPLNDVDVHANDLNFIAISK
DGKLVGFNVLVGGGLAMTHGDHATFPRKASDFGFIKVEDTLAIAEAVVSTQRDWGNRVNR
KNAKTKYTLERVGVENFKAEVEKRSGVTFGESQAYEFTERGDRIGWVEGIDGKHHLTLFI
ENGRILDYPGKPLKTGCAEIAKIHDGDFRLTANQNLIVAGVSEQNKAKVEEIARAHGLIE
DDLSAQRKDSMACVALPTCPLAMAEAERYLPEAVTQLEGILAKHAIAQKSIIYRVTGCPN
GCGRSMLAEIGLVGKGPGKYNLHLGGNRQGTRIPKMYKENIGEQQIMDELDVLIGQWAKE
AQSDESFGDFVIRTGVIAEVVNSAEDFYA
Download sequence
Identical sequences Q15NK1
WP_011576734.1.28837 gi|109900336|ref|YP_663591.1| 342610.Patl_4038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]