SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|109896495|ref|YP_659750.1| from Pseudoalteromonas atlantica T6c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|109896495|ref|YP_659750.1|
Domain Number 1 Region: 1-345
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.75e-130
Family AstA-like 0.000000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|109896495|ref|YP_659750.1|
Sequence length 346
Comment arginine N-succinyltransferase [Pseudoalteromonas atlantica T6c]
Sequence
MLVIRPICAADFAALKQIAVESGHGFTSLPDNDELLLSKISRAQKSFTEQVTSPGQQNYL
FVLEDTQSKEIIGVTGIEAAVGLNAPFYHYHIASHVHYSERLGVKKVVETLNLCNDYTGA
SEVCTLFVREKFRRGFAGQLLSRVRYLFMANHPERFSDLVIAEMRGVSDENGHSPFWAWL
EPNFFGIDFPTADYLVGMGDKSFIAELMPKHPIYVALLSKDAQNVIGQVHEKTAPALRLL
QKEGFFHRGYVDLFDAGPTVEVALKNIRTVQQSQLATVLITDKSQLPTTDSGAQNYMLCS
TDVSQFRATITPCIRYENESNTLLISAEMASELGLMNASDVRFIGL
Download sequence
Identical sequences Q15ZJ2
WP_011573102.1.28837 342610.Patl_0164 gi|109896495|ref|YP_659750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]