SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|109896911|ref|YP_660166.1| from Pseudoalteromonas atlantica T6c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|109896911|ref|YP_660166.1|
Domain Number 1 Region: 317-459
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.53e-21
Family Autoinducer synthetase 0.024
Further Details:      
 
Domain Number 2 Region: 57-162
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00000196
Family Glycerol-3-phosphate (1)-acyltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|109896911|ref|YP_660166.1|
Sequence length 584
Comment phospholipid/glycerol acyltransferase [Pseudoalteromonas atlantica T6c]
Sequence
MTTAITLLNLVPQEKQTAILTGVMGLLDKLLAIHRLDHLYREHHLTGLNKEAFAKALLEA
LNVTVEGTDVLQKKVPQNGPLVIASNHPFGGIEGVILAYVIGQIRPDLKVLANQGLALFT
ELKDYFIFTNPLSERDPKNAPSLRESLRHVKQGGALLIFPAGRVSYYQADKKRISEHQWN
RIVANLVTRTGAQYLALFVSGENSPLFYHLGRVYYRLRMLMLPRELLNKRDTSIKISAAT
CVPANAFAANTDDIELSALQRIQSYTQDPTWRHTWPASNVVAMQPLISQVPGSVINTELA
QLDESQTLLSYRNLDVYYAYYEQIPQTVKEIARLRELVFREHDEGSGNSLDTDDFDKTYT
HLFIVERDLGRIIGAYRMGQSDRLLANASLNIDPFYLSAMFNFSADFINRQAPCLEMGRS
FLIPEYQNSFQGLLLLWRGIGRFVCQFPQYRTLYGTVSLSKLYDPRSVSLIEHALVTPTR
NATARTQLGFSVPPEIADFAKQYPLKKHLTSLLAGIESDGKDVPILLKHYQKLGAKFHCL
GIDSNFNHTPGLLLSVELAKAPEKLGRLYLGDGWKAYKCHQENQ
Download sequence
Identical sequences Q15YC6
gi|109896911|ref|YP_660166.1| 342610.Patl_0583 WP_011573487.1.28837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]