SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|109897452|ref|YP_660707.1| from Pseudoalteromonas atlantica T6c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|109897452|ref|YP_660707.1|
Domain Number 1 Region: 342-445
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.21e-25
Family Ferredoxin reductase FAD-binding domain-like 0.00036
Further Details:      
 
Domain Number 2 Region: 450-607
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.54e-25
Family Flavohemoglobin, C-terminal domain 0.016
Further Details:      
 
Domain Number 3 Region: 595-703
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.09e-18
Family 2Fe-2S ferredoxin-related 0.012
Further Details:      
 
Domain Number 4 Region: 201-302
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.0000816
Family PNP-oxidase like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|109897452|ref|YP_660707.1|
Sequence length 711
Comment oxidoreductase FAD-binding region [Pseudoalteromonas atlantica T6c]
Sequence
MKLTHTHTPFHNGERQLQASVGALEQMDDIGRRAIRAYMPEQHRQFFQQLPFMILGSTTN
EGQLWASILPGKPGFVQSPFPTKLTVNTPILTGDPLASAVKQGARLGLLGLEMPTRRRNR
VNATVTGVSNHQLELDVEQSFGNCPQYIQTREIQFVRSPDAPIQAPVIEEFTELSASLTA
FIGQADTFFVASSAGQNPQHTVSNGEPTRSTMGVDVSHRGGMPGFIKVQGNTLTIPDYAG
NNFFNTLGNFVINPKAGLLFVDFTTGDVFMLTGEVTLLASDSPLIEGFQGALRGWQFTLI
RGITLKAALPFRAAFESYSANAKATGTWAQAEAIIKAQAQRNQWRPFIVTKIEDESSTIR
SFYLCPSDNVPVLPSSPGQHLTLRIKQPNTDKWLVRNYTVSSAPTGNYYRISVKRECHGQ
VSSALHANVRVGSEIYIKAPSGHFFIDNKQRRSAVLIGAGVGITPMLSMANDALGEGLRS
RYVRPMAVIQAAKDRHQRGFYQELSDIANRSAGRIQYYSVLSDIDAGKPPKPVPSIDYTT
QGRINHTLLLGVLNTMGTANSNDATSLFDKDFYLCGPQGFMQSIYDVLIELGVQDKDIHA
EAFGPSSLVRQTVDLRARAEQEAESALIIFAQSGIEQSWNRGDKSLLEVAESSGLTPEYS
CRNGQCGSCAAKLLSGSVTYRNNPSAHVDESEILLCCAVPAKDSQTIALAL
Download sequence
Identical sequences Q15WT5
WP_011573988.1.28837 gi|109897452|ref|YP_660707.1| 342610.Patl_1127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]