SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2902.m00012|PY07721|PY07721|DNA from Plasmodium yoelii ssp. yoelii 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2902.m00012|PY07721|PY07721|DNA
Domain Number 1 Region: 185-353
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 3.6e-63
Family Adenylation domain of NAD+-dependent DNA ligase 0.00000579
Further Details:      
 
Domain Number 2 Region: 48-164
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 3.66e-31
Family Cell-division protein ZipA, C-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2902.m00012|PY07721|PY07721|DNA
Sequence length 354
Comment ligase, NAD-dependent, putative|p_yoelii|chr_0|MALPY02902|2902
Sequence
GHGPGSRERRTSRAAGEADAGGRVDELPREAVEEPPAGTSRALGAPFLIQLSVVKGGGGR
FSGERLRDALIDLDLVYGEMGIFHRYDSAYREPLFSVASLVEPGTFPVNDMENFRTPGVV
FFFQPAKVPDPLEVFDDLVDTCRGLAGALEGRVLDEHRAELTEXPGDRNARNSGGSVRTV
VSVPAEVVEKARKLREEIEFHNVRYYRLDDPLITDAEYDRLMAELLAIEARYPELVTPDS
PTQRVGAPPVEAFTEVRHEVPMLSLENAFSEEDLTAFDRRVRKELSRDTLEYVAEPKLDG
LAVNLLYQDGVLVRAATRGDGEVGEDVTHNVRAVRAIPLRLKGEDFPDRFEGAG
Download sequence
Identical sequences Q7R767
gi|82913524|ref|XP_728678.1| 73239.Q7R767 2902.m00012|PY07721|PY07721|DNA XP_728678.1.76580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]