SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Acral1_c3a|1083083|estExt_fgenesh2_pg.C_70441 from Acremonium alcalophilumv 1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Acral1_c3a|1083083|estExt_fgenesh2_pg.C_70441
Domain Number - Region: 38-79
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0654
Family AF0587 pre C-terminal domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Acral1_c3a|1083083|estExt_fgenesh2_pg.C_70441
Sequence length 127
Sequence
MYNVYLVELLGFPRNHHRIFVELDADDGTGYVFHVTGDIQTGMTYETKPGRKPEETHLFV
TKTALGRVDPRDYGRVDIICRSVPPPKKQFEGAKRLYPREPLVRCQEWAQQAVQALKNEG
VLCETGG
Download sequence
Identical sequences jgi|Acral1_c3a|1083083|estExt_fgenesh2_pg.C_70441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]