SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518656789|ref|YP_008143151.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518656789|ref|YP_008143151.1|
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily CheY-like 8.4e-41
Family CheY-related 0.00016
Further Details:      
 
Domain Number 2 Region: 129-230
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 7.37e-30
Family PhoB-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|518656789|ref|YP_008143151.1|
Sequence length 235
Comment response regulator of two-component system [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MTRILVVEDEPSYLDPLLYQLTREGYEAHGAATGEEAWELYEEMEFDLVLLDLMLPGISG
TTLCRRMHELRRVPIIMVTAKSTENDVIVGLEIGADDYVTKPYSFRELLARIHAVLRRSL
EPRASGTPGGNDETLTCGPIEMSVASHEVRIHGELTQFPLKEFEVLEYLMRNKGRVLTRQ
QLIGRVWGSDYVGDTKTLDVHVKRIRAKIEADPSNPALLTTVRGLGYRICDERSR
Download sequence
Identical sequences A0A2G9IRV9 B8DVX7
gi|241195803|ref|YP_002969358.1| 442563.BLA_0326 555970.Balat_0342 580050.Balac_0342 gi|219682821|ref|YP_002469204.1| gi|387821929|ref|YP_006301878.1| gi|384193397|ref|YP_005579143.1| gi|518656789|ref|YP_008143151.1| WP_004268504.1.14456 WP_004268504.1.20477 WP_004268504.1.22654 WP_004268504.1.23267 WP_004268504.1.23846 WP_004268504.1.23969 WP_004268504.1.26294 WP_004268504.1.34099 WP_004268504.1.38287 WP_004268504.1.38998 WP_004268504.1.45260 WP_004268504.1.45775 WP_004268504.1.47471 WP_004268504.1.47549 WP_004268504.1.50484 WP_004268504.1.53490 WP_004268504.1.62237 WP_004268504.1.66072 WP_004268504.1.75174 WP_004268504.1.78909 WP_004268504.1.86686 WP_004268504.1.86797 WP_004268504.1.94304 gi|387820264|ref|YP_006300307.1| gi|384194953|ref|YP_005580698.1| gi|241190397|ref|YP_002967791.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]