SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518656838|ref|YP_008143200.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518656838|ref|YP_008143200.1|
Domain Number 1 Region: 3-61
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.92e-22
Family Ribosomal protein S14 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|518656838|ref|YP_008143200.1|
Sequence length 61
Comment 30S ribosomal protein S14 [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MAKTCLKVKALRKPKFKVRAYTRCMVCGRPHSVYRKFGLCRICLREKAHRGELPGVTKSS
W
Download sequence
Identical sequences A0A087AC16 A0A087AE75 A0A087C6I4 A0A087C7T6 A0A0A7I6L4 A0A0L7BLM4 A0A0L7CW59 A0A1C7FX39 A0A248X5P3 A0A2A2EHB4 A0A2A2EMN5 B8DW26 D3R3U2
gi|549471893|ref|YP_008605600.1| gi|241190446|ref|YP_002967840.1| WP_004268593.1.11389 WP_004268593.1.14456 WP_004268593.1.16162 WP_004268593.1.18606 WP_004268593.1.20477 WP_004268593.1.21588 WP_004268593.1.22654 WP_004268593.1.23267 WP_004268593.1.23846 WP_004268593.1.23969 WP_004268593.1.26294 WP_004268593.1.27023 WP_004268593.1.27029 WP_004268593.1.3353 WP_004268593.1.34099 WP_004268593.1.38287 WP_004268593.1.38998 WP_004268593.1.42329 WP_004268593.1.43840 WP_004268593.1.45260 WP_004268593.1.45448 WP_004268593.1.45775 WP_004268593.1.47471 WP_004268593.1.47549 WP_004268593.1.48389 WP_004268593.1.50484 WP_004268593.1.50534 WP_004268593.1.52823 WP_004268593.1.53490 WP_004268593.1.61317 WP_004268593.1.62237 WP_004268593.1.6584 WP_004268593.1.66072 WP_004268593.1.70365 WP_004268593.1.72402 WP_004268593.1.72895 WP_004268593.1.75174 WP_004268593.1.75271 WP_004268593.1.75953 WP_004268593.1.76386 WP_004268593.1.78909 WP_004268593.1.81650 WP_004268593.1.8417 WP_004268593.1.86686 WP_004268593.1.86797 WP_004268593.1.89833 WP_004268593.1.9105 WP_004268593.1.94304 gi|518656838|ref|YP_008143200.1| gi|384190678|ref|YP_005576426.1| gi|386866602|ref|YP_006279596.1| gi|384195002|ref|YP_005580747.1| gi|384193446|ref|YP_005579192.1| gi|387820313|ref|YP_006300356.1| gi|219682870|ref|YP_002469253.1| 442563.BLA_0375 555970.Balat_0395 580050.Balac_0395 gi|384191820|ref|YP_005577567.1| gi|241195852|ref|YP_002969407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]