SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518656870|ref|YP_008143232.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518656870|ref|YP_008143232.1|
Domain Number 1 Region: 8-141
Classification Level Classification E-value
Superfamily CheY-like 2.56e-25
Family CheY-related 0.001
Further Details:      
 
Domain Number 2 Region: 169-235
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.22e-21
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|518656870|ref|YP_008143232.1|
Sequence length 236
Comment two-component LuxR family transcriptional response regulator [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MSERERQGIRIAVVDDHEMFRAGVIATLQPYFTIVGQAADVPSAIEMIADTQPDVVLLDV
HVPGGEGGGGAEILRKSQPHAPQTAFLALSVSDSAQDVGSVIRAGARGYVTKTITGNDLI
HSIEQVSDGYAVFSPKLAGFVLSAFQGAPLSDGMDASNESAAGGDTVAHDAELDSLSTRE
QEVMRLIARGYTYKEVGAELFISVKTVETHVSNVLRKLQLSNRNELTLWAADRHIV
Download sequence
Identical sequences B8DW58 D3R3X7
gi|241190478|ref|YP_002967872.1| gi|387822012|ref|YP_006301961.1| 442563.BLA_0407 555970.Balat_0429 580050.Balac_0429 gi|549471926|ref|YP_008605633.1| gi|219682902|ref|YP_002469285.1| WP_004268661.1.14456 WP_004268661.1.16162 WP_004268661.1.20477 WP_004268661.1.21588 WP_004268661.1.22654 WP_004268661.1.23267 WP_004268661.1.23846 WP_004268661.1.23969 WP_004268661.1.26294 WP_004268661.1.34099 WP_004268661.1.38287 WP_004268661.1.38998 WP_004268661.1.45260 WP_004268661.1.45775 WP_004268661.1.47471 WP_004268661.1.47549 WP_004268661.1.50484 WP_004268661.1.53490 WP_004268661.1.62237 WP_004268661.1.66072 WP_004268661.1.75174 WP_004268661.1.78909 WP_004268661.1.86686 WP_004268661.1.86797 WP_004268661.1.94304 gi|241195884|ref|YP_002969439.1| gi|387820345|ref|YP_006300388.1| gi|384195034|ref|YP_005580779.1| gi|384190713|ref|YP_005576461.1| gi|384191856|ref|YP_005577603.1| gi|384193479|ref|YP_005579225.1| gi|518656870|ref|YP_008143232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]