SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518656941|ref|YP_008143303.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518656941|ref|YP_008143303.1|
Domain Number 1 Region: 5-445
Classification Level Classification E-value
Superfamily Xylose isomerase-like 1.99e-150
Family Xylose isomerase 0.000000000321
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|518656941|ref|YP_008143303.1|
Sequence length 450
Comment xylose isomerase [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MAGLWDIDKIEYVGRTKGLQEGLGFQYYDADKVVAGKKMKDWLRFGVAWWHTFDAPLTDP
FGDGTAQRPWDGKYSDPMDNALAKVDYAFEFFTKLGAEYFCFHDRDIAPEGDTLRETNAN
LDRVVDKIEENMQSTGVKLLWNTSSLFTNPRFVAGASTSPFADVYAYAAAQLKHSLEIGK
RLGAENYVFWGGREGYENLWVTDMKREQEHMAKFFHMCADYAKQIGMDAQFLIEPKAKEP
TTHQYDFDAATACNFLRAYDLIDVFKLNLEGNHANLAGHTYQHEIRVARDNGVLGSLDAN
QGDMLLGWDLDEFPTNLYETTSVMWEVLDEGQIGPHGGLNFDAKPRRTSFSAEDLFRAHI
AGMDSFAAGLLVADKMHQDKYIEDLVANRYGSYDSGIGKSIDDGTATLESLNDYAIDMPQ
SEIIASTHPDHLEDVKATINNYIIDALANA
Download sequence
Identical sequences A0A2G9IST6 B8DWD3
gi|219682977|ref|YP_002469360.1| WP_004219358.1.14456 WP_004219358.1.16162 WP_004219358.1.20477 WP_004219358.1.21588 WP_004219358.1.22654 WP_004219358.1.23267 WP_004219358.1.23846 WP_004219358.1.23969 WP_004219358.1.26294 WP_004219358.1.34099 WP_004219358.1.38287 WP_004219358.1.38998 WP_004219358.1.45775 WP_004219358.1.47471 WP_004219358.1.47549 WP_004219358.1.50484 WP_004219358.1.53490 WP_004219358.1.62237 WP_004219358.1.66072 WP_004219358.1.75174 WP_004219358.1.78909 WP_004219358.1.86686 WP_004219358.1.86797 WP_004219358.1.94304 gi|241195960|ref|YP_002969515.1| gi|518656941|ref|YP_008143303.1| gi|241190554|ref|YP_002967948.1| gi|384193553|ref|YP_005579299.1| gi|387822090|ref|YP_006302039.1| 442563.BLA_0485 555970.Balat_0511 580050.Balac_0511 gi|549471997|ref|YP_008605704.1| gi|384195110|ref|YP_005580855.1| gi|387820421|ref|YP_006300464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]