SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518656981|ref|YP_008143343.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518656981|ref|YP_008143343.1|
Domain Number 1 Region: 11-180
Classification Level Classification E-value
Superfamily CheY-like 8.29e-21
Family CheY-related 0.0087
Further Details:      
 
Domain Number 2 Region: 161-221
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000000553
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|518656981|ref|YP_008143343.1|
Sequence length 228
Comment two component transcriptional regulator, LuxR family [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MYTNMNPDSEPWNIALVDNDALVRSYLETYLGGLPEFNICWSMQSGRDAVEAYHHSIACT
NCVPDLIVTDLSMHGMSGFELCATIRFENDHTPILGCSSYMIEPYERDAVNNGMQGLLLK
NELAQLADGMRTLLSGQPLLKSNGMPYETPQQAHERLLMQGKPAIMSMSPNEQAVMELCS
EGLSTRTIAEETGDSESTVKTYISRAMRKLRAKSRAEAVASWSRKTKL
Download sequence
Identical sequences D3R4A6
gi|518656981|ref|YP_008143343.1| gi|549472036|ref|YP_008605743.1| gi|384193593|ref|YP_005579339.1| gi|384191984|ref|YP_005577731.1| gi|384195152|ref|YP_005580897.1| 555970.Balat_0553 580050.Balac_0553 WP_004218794.1.14456 WP_004218794.1.16162 WP_004218794.1.20477 WP_004218794.1.21588 WP_004218794.1.22654 WP_004218794.1.23267 WP_004218794.1.23846 WP_004218794.1.23969 WP_004218794.1.26294 WP_004218794.1.34099 WP_004218794.1.38287 WP_004218794.1.38998 WP_004218794.1.45260 WP_004218794.1.45775 WP_004218794.1.47471 WP_004218794.1.47549 WP_004218794.1.50484 WP_004218794.1.53490 WP_004218794.1.62237 WP_004218794.1.66072 WP_004218794.1.75174 WP_004218794.1.78909 WP_004218794.1.86686 WP_004218794.1.86797 WP_004218794.1.94304 gi|241190596|ref|YP_002967990.1| gi|241196002|ref|YP_002969557.1| gi|384190842|ref|YP_005576590.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]