SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518656982|ref|YP_008143344.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518656982|ref|YP_008143344.1|
Domain Number 1 Region: 261-630
Classification Level Classification E-value
Superfamily SIS domain 2.23e-100
Family double-SIS domain 0.000000388
Further Details:      
 
Domain Number 2 Region: 2-248
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.72e-58
Family Class II glutamine amidotransferases 0.00000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|518656982|ref|YP_008143344.1|
Sequence length 630
Comment glucosamine--fructose-6-phosphate aminotransferase [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MCGIVGYAGSVLCPSDKPLEVCLQGLERLEYRGYDSAGVALVAPGMDRVRVRKKAGRLSN
LVADIESDPLPEATVAIGHTRWATNGVPNDVNAHPHSSMDGRVAIIHNGIIENASQLRLD
LQAEGYRFVSGTDTEVAAKLLGKIVDAVIAETGGPDLFEAVRRLGRMLEGAFTILAIDCR
QPGVVVGARHDSPLVVGLGEGENYLGSDVAAFVAYTRTAMEIDQDQAVMISAGGVTVTDF
DGNVVEDPTVFEVDWDASAAEKGGWDSFMDKEIHEEPAAVQRTLIGRLDDTGSINLDEVR
IDEHDFTMIDKIIVIGCGTASYAGLVAKYAIEHWVRIPVEVELAHEFRYRDPILTPRTLV
VAISQSGETMDTLMALRHAREQGSKVLAICNTQGASIPREADAVLYTHAGPEVAVASTKA
FVAQITATYVLGLYLAQLKGTVFRDEIRQTLDSLKAMPAKIQWVLDTQPDRVQRAAEQLQ
DAQSFLFLGRHVGYPVALEGALKLKEIAYTFTEGFAAGELKHGPIALVDEGEPVVFIVPP
ARGRNTLHAKVISGIEEVKARGAYIIAVAEENDKDVERYADMIFWRPECPTLMSPLVDIV
PLQLFAMDMARQKGYDVDKPRNLAKSVTVE
Download sequence
Identical sequences A0A2G9ISR9 B8DTP5
gi|518656982|ref|YP_008143344.1| 442563.BLA_1086 gi|452892203|ref|YP_005579340.2| WP_004269062.1.14456 WP_004269062.1.20477 WP_004269062.1.22654 WP_004269062.1.23267 WP_004269062.1.23846 WP_004269062.1.23969 WP_004269062.1.26294 WP_004269062.1.34099 WP_004269062.1.38287 WP_004269062.1.38998 WP_004269062.1.45260 WP_004269062.1.45775 WP_004269062.1.47471 WP_004269062.1.47549 WP_004269062.1.50484 WP_004269062.1.53490 WP_004269062.1.62237 WP_004269062.1.66072 WP_004269062.1.75174 WP_004269062.1.78909 WP_004269062.1.86686 WP_004269062.1.86797 WP_004269062.1.94304 gi|219683567|ref|YP_002469950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]