SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518657085|ref|YP_008143447.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518657085|ref|YP_008143447.1|
Domain Number 1 Region: 6-130
Classification Level Classification E-value
Superfamily CheY-like 1.71e-42
Family CheY-related 0.00019
Further Details:      
 
Domain Number 2 Region: 128-239
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 6.24e-26
Family PhoB-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|518657085|ref|YP_008143447.1|
Sequence length 245
Comment two-component response regulator [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MSKATEATIVVVDDEPSIRELLVASLHFAGYEVETAASGSEAIEVISRTKPDMIILDVML
PDIDGFTVTRRIRQEGITAPVLFLTARDDTQDKVMGLTVGGDDYVTKPFSLEEVVARIRA
ILRRTREQVEDDPIIRVGDLEINEDSHDVTRAGQTIDLSPTEYKLLRYLMDNEGRVLSKA
QILDHVWQYDWGGDAAIVESYISYLRKKVDDVTVTDEDGSTHKVTPLIETKRGIGYMIRA
PKAQK
Download sequence
Identical sequences A0A2G9ISG9 Q5YBV0
gi|518657085|ref|YP_008143447.1| gi|384193697|ref|YP_005579443.1| gi|549472139|ref|YP_008605846.1| WP_004269071.1.14456 WP_004269071.1.16162 WP_004269071.1.20477 WP_004269071.1.21588 WP_004269071.1.22654 WP_004269071.1.23267 WP_004269071.1.23846 WP_004269071.1.23969 WP_004269071.1.26294 WP_004269071.1.34099 WP_004269071.1.38287 WP_004269071.1.38998 WP_004269071.1.45260 WP_004269071.1.45775 WP_004269071.1.47471 WP_004269071.1.47549 WP_004269071.1.50484 WP_004269071.1.53490 WP_004269071.1.66072 WP_004269071.1.75174 WP_004269071.1.78909 WP_004269071.1.86686 WP_004269071.1.86797 WP_004269071.1.94304 gi|387822244|ref|YP_006302193.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]